Link2097 Posted August 6, 2013 Share Posted August 6, 2013 hey just registered GameEx and loving it. but I am having an issue with the steam integration, it will find some of my games but not all of them it is very strange.i dont see how it can find some of my steam games that are in the same place as others that it doesnt find. if it would help to provide any files or logs or any other info i am not thinking of please ask. Link to comment Share on other sites More sharing options...
AlphaUMi Posted August 6, 2013 Share Posted August 6, 2013 You must launch a game at least once through Steam. Then launch GameEx and it will detect your game. Or at least this is the behavior it had with me... 1 Link to comment Share on other sites More sharing options...
Link2097 Posted August 6, 2013 Author Share Posted August 6, 2013 You must launch a game at least once through Steam. Then launch GameEx and it will detect your game. Or at least this is the behavior it had with me...Hmm I thought for sure that would do it but sadly no still only a portion of my installed steam library is showing up inside: Start Screen -> Emulated Games -> Steam Gamesfor example i started up torchlight 2 and sonic adventure 2 both of which i had not launched since i installed them through steam so they did their first time setup and what not and then i fired up gameex and still doesnt show them. Link to comment Share on other sites More sharing options...
nullPointer Posted August 7, 2013 Share Posted August 7, 2013 Hi Link2097 and welcome to the GameEx forums!When you have a moment please post a copy of your GameEx log after having experienced the problem within GameEx. Also please post your steamdata.ini found in the following directory:\GameEx\DATA\steamdata.iniIt would also be helpful to have a look at your gameex.ini, but that would be of secondary importance to the other requested files in this case. Please refer to the How to Ask For Help thread for details on how to access your log and gameex.ini.Thanks Link2097! I'm fairly confident we can get you on the right track here. Link to comment Share on other sites More sharing options...
Link2097 Posted August 7, 2013 Author Share Posted August 7, 2013 Hi Link2097 and welcome to the GameEx forums!When you have a moment please post a copy of your GameEx log after having experienced the problem within GameEx. Also please post your steamdata.ini found in the following directory:\GameEx\DATA\steamdata.iniIt would also be helpful to have a look at your gameex.ini, but that would be of secondary importance to the other requested files in this case. Please refer to the How to Ask For Help thread for details on how to access your log and gameex.ini.Thanks Link2097! I'm fairly confident we can get you on the right track here.Here are the steamdata.ini and log. it is also very strange for example you will see something in there called "Save 75% off of skyrim or something like that" which isnt even a game and i have skyrim and it is one of the ones not showing up.sorry if i wasnt supposed to just copy/paste the whole long thing here. This is the log18:47:17.1 8/6/2013: Opening Configuration File18:47:17.1 8/6/2013: GameEx: Version 13.14: Starting Log18:47:17.1 8/6/2013: Operating System Platform: Win32NT18:47:17.1 8/6/2013: Operating System Name: Windows 718:47:17.1 8/6/2013: Operating System Version: 6.1.760118:47:17.1 8/6/2013: Aero running18:47:17.1 8/6/2013: Initializing Vista/Windows 7 volume control18:47:17.1 8/6/2013: Getting CPU and RAM info18:47:17.1 8/6/2013: Intel® Core i7 CPU 920 @ 2.67GHz, 12279MB18:47:17.1 8/6/2013: 2.69Ghz - 8 Cores or CPU's18:47:17.1 8/6/2013: Running Randomize()18:47:17.1 8/6/2013: Loading PlugIns18:47:17.1 8/6/2013: Checking for applications to Launch On Startup18:47:17.1 8/6/2013: Setting default net connection limit to 1518:47:17.1 8/6/2013: Running Misc startup tasks18:47:17.1 8/6/2013: Setting Menu types18:47:17.1 8/6/2013: Getting Configuration Values18:47:17.2 8/6/2013: Using Theme: Default - Media Center18:47:17.2 8/6/2013: Checking for alternate Image Directory for Theme: Default - Media Center18:47:17.2 8/6/2013: Using Images from theme: Default - Media Center V1\MEDIA\18:47:17.2 8/6/2013: GameEx will display on Secondary Device18:47:17.2 8/6/2013: Launching HideOS.exe18:47:17.2 8/6/2013: Initialising Video/MNG DLL's18:47:17.2 8/6/2013: GameEx will check for media insertion (may affect performance)18:47:17.2 8/6/2013: Hiding Taskbar18:47:17.2 8/6/2013: Is Media Center running?18:47:17.2 8/6/2013: Checking/Creating LCD Registry values18:47:17.2 8/6/2013: Check Media Center Exit/Start Mode18:47:17.2 8/6/2013: Media Center Mode 218:47:17.2 8/6/2013: Video previews on. Warning: Only recommended on modern systems18:47:17.2 8/6/2013: Snap Delay set to: 718:47:17.2 8/6/2013: Get other settings18:47:17.2 8/6/2013: Desktop set to Hide ICONS and set Background to Black18:47:17.2 8/6/2013: Set: Find emulator artwork on best match basis18:47:17.2 8/6/2013: Start work for Form18:47:17.2 8/6/2013: Getting Original Screen Size18:47:17.2 8/6/2013: Opening Database Connection18:47:17.3 8/6/2013: Initializing Component18:47:17.3 8/6/2013: MAME Path is: G:\STUFF\Emulators\MAME18:47:17.3 8/6/2013: AdvanceMAME Path is: G:\STUFF\Emulators\Advancemame18:47:17.3 8/6/2013: AdvanceMAME EXE file is: advmame.exe18:47:17.3 8/6/2013: Use AdvanceMAME on. advmame.exe will launch games18:47:17.3 8/6/2013: MAME EXE file is: mame.exe18:47:17.3 8/6/2013: Cannot find the ROM path: G:\STUFF\ROMS\MAME\CHD18:47:17.3 8/6/2013: ROM Paths are: G:\STUFF\ROMS\MAME18:47:17.3 8/6/2013: Catver.ini is located at: G:\STUFF\GameEx\DATA\catver.ini18:47:17.3 8/6/2013: controls.ini is located at: G:\STUFF\GameEx\DATA\controls.ini18:47:17.4 8/6/2013: History.dat is located at: G:\STUFF\GameEx\DATA\history.dat18:47:17.4 8/6/2013: nplayers.ini is located at: G:\STUFF\GameEx\DATA\nplayers.ini18:47:17.4 8/6/2013: command.dat is located at: G:\STUFF\GameEx\DATA\command.dat18:47:17.4 8/6/2013: MAMEinfo.dat is located at: G:\STUFF\GameEx\DATA\mameinfo.dat18:47:17.4 8/6/2013: Loading Controls.ini map file18:47:17.4 8/6/2013: Snap Path is: G:\STUFF\Assets\MAME\Snap18:47:17.4 8/6/2013: Background Snap Path is: G:\STUFF\Assets\MAME\Snap18:47:17.4 8/6/2013: AVI Snap Path is: G:\STUFF\Assets\MAME\Video_MP418:47:17.4 8/6/2013: Flyer Path is: G:\STUFF\Assets\MAME\Advert18:47:17.4 8/6/2013: Cabinet Path is: G:\STUFF\Assets\MAME\Cabinet18:47:17.4 8/6/2013: Cabinet 3D Path: Not Found18:47:17.4 8/6/2013: Title Path is: G:\STUFF\Assets\MAME\Title18:47:17.4 8/6/2013: PCB Path is: G:\STUFF\Assets\MAME\PCB18:47:17.4 8/6/2013: Artwork Preview Path is: G:\STUFF\Assets\MAME\Artwork_Preview18:47:17.4 8/6/2013: Panel Path is: G:\STUFF\Assets\MAME\Controls18:47:17.4 8/6/2013: Manual Path is: G:\STUFF\Assets\MAME\Manuals18:47:17.4 8/6/2013: Icon Path is: G:\STUFF\Assets\MAME\Icon18:47:17.4 8/6/2013: Marquee Path is: G:\STUFF\Assets\MAME\Marquee18:47:17.4 8/6/2013: Applying Language/Text18:47:17.4 8/6/2013: Text/Language: English18:47:17.4 8/6/2013: Loading Language/Text18:47:17.4 8/6/2013: Loading Custom Emulators18:47:17.4 8/6/2013: Loading Emulator 1: Atari 260018:47:17.4 8/6/2013: Loading Emulator 2: Nintendo SNES18:47:17.4 8/6/2013: Loading Emulator 3: Nintendo N6418:47:17.4 8/6/2013: Loading Emulator 4: Nintendo NES18:47:17.4 8/6/2013: Loading Emulator 5: Nintendo GameCube18:47:17.4 8/6/2013: Loading Emulator 6: Nintendo Game Boy Advance18:47:17.4 8/6/2013: Loading Emulator 7: Sega Master System18:47:17.4 8/6/2013: Loading Emulator 8: Sega Genesis18:47:17.4 8/6/2013: Loading Emulator 9: Sega Dreamcast18:47:17.4 8/6/2013: Loading Emulator 10: Sony Playstation18:47:17.4 8/6/2013: Loading Emulator 11: Sony Playstation 218:47:17.4 8/6/2013: Loading Emulator 12: Future Pinball18:47:17.4 8/6/2013: Checking if Steam enabled18:47:17.4 8/6/2013: Steam is installed correctly18:47:17.5 8/6/2013: Found: D:\\Program Files (x86)\\Steam\\steamapps\\common\\Team Fortress 218:47:17.5 8/6/2013: Found Steam game. Steam enabled.18:47:17.5 8/6/2013: Using Version 3 Themes Animations18:47:17.5 8/6/2013: Retrieving resolution setting18:47:17.5 8/6/2013: Using General Font: Trebuchet MS18:47:17.5 8/6/2013: Using Title Font: Trebuchet MS18:47:17.5 8/6/2013: GameEx will try to reduce CPU usage18:47:21.0 8/6/2013: Initialising Direct3D18:47:21.1 8/6/2013: Applying GameEx is Loading Image18:47:21.1 8/6/2013: Setting Resolution to 1920x1080 32 bit color18:47:21.1 8/6/2013: Creating Surfaces18:47:21.4 8/6/2013: Creating Primary Surface - Full Screen Mode18:47:21.4 8/6/2013: Creating Back Buffer18:47:21.4 8/6/2013: Loading graphic Surfaces18:47:21.4 8/6/2013: Display is running at: 1920x1080 32bit color, 60hz18:47:21.4 8/6/2013: Adapter: NVIDIA GeForce GTX 67018:47:21.4 8/6/2013: Max texture size: 8192x819218:47:21.4 8/6/2013: Available texture memory: -77MB18:47:21.4 8/6/2013: Initialising Bass Audio Library18:47:21.4 8/6/2013: Creating Surfaces Misc and Dialogs18:47:21.5 8/6/2013: Creating Surfaces Volume18:47:21.5 8/6/2013: Creating Surfaces Arrows18:47:21.5 8/6/2013: Creating Surfaces GameEXlogo Text18:47:21.5 8/6/2013: Creating Surfaces Toolbar18:47:21.6 8/6/2013: Creating Surfaces Toolbar Controls18:47:21.6 8/6/2013: Creating Surfaces Backgrounds18:47:21.6 8/6/2013: Creating Surfaces GameEx Logo18:47:21.6 8/6/2013: Creating Surface Unselected18:47:21.6 8/6/2013: Creating Surfaces Snaps18:47:21.6 8/6/2013: Creating Surfaces Menu and List Bars18:47:21.8 8/6/2013: Creating Fonts18:47:21.8 8/6/2013: Creating Game Font18:47:21.9 8/6/2013: Creating Game Font Faded18:47:22.0 8/6/2013: Creating Title Font18:47:22.0 8/6/2013: Restoring Title Font From Cache18:47:22.2 8/6/2013: Creating Font Black18:47:22.2 8/6/2013: Creating Font Black Small18:47:22.3 8/6/2013: Fonts Created Succesfully18:47:22.7 8/6/2013: Attempting to load game list18:47:22.7 8/6/2013: MAME CMD options: -nowindow -joy -skip_gameinfo18:47:22.8 8/6/2013: Loading music18:47:23.2 8/6/2013: Initialising DirectInput for Gamepad support18:47:23.4 8/6/2013: Using Device Controller (XBOX 360 For Windows)18:47:23.6 8/6/2013: Loading Start Page18:47:23.6 8/6/2013: Initializing MCE Remote18:47:23.6 8/6/2013: Playing intro sound file18:47:23.7 8/6/2013: Initialization OK! Starting GameEx!18:47:23.7 8/6/2013: Testing Main Loop Once: Processing Frame18:47:23.9 8/6/2013: Testing Main Loop Once: Main Loop ran successfully18:47:27.5 8/6/2013: Validating: Emulator_1: Snap Path: G:\STUFF\Assets\Atari_2600\Atari 2600\Snaps18:47:27.5 8/6/2013: Validating: Emulator_1: Background Snap Path: G:\STUFF\Assets\Atari_2600\Background18:47:27.5 8/6/2013: Validating: Emulator_1: Control Panel Path: G:\STUFF\Assets\Atari_2600\Atari 2600\Controls18:47:27.5 8/6/2013: Validating: Emulator_1: Database: [Console] Atari 260018:47:27.5 8/6/2013: Validating: Emulator_1: Title Snap Path: G:\STUFF\Assets\Atari_2600\Title18:47:27.5 8/6/2013: Warning: Emulator_1: Title Snap Path Does not exist18:47:27.5 8/6/2013: Validating: Emulator_1: Box Art Path: G:\STUFF\Assets\Atari_2600\Box18:47:27.5 8/6/2013: Validating: Emulator_1: Cart Art Path: G:\STUFF\Assets\Atari_2600\Cart18:47:27.5 8/6/2013: Validating: Emulator_1: Manual Path: G:\STUFF\Assets\Atari_2600\Atari 2600\Manuals18:47:27.5 8/6/2013: Caching Video Snap Path18:47:27.6 8/6/2013: Caching Snap Path18:47:27.6 8/6/2013: Caching Box Path18:47:27.6 8/6/2013: Caching Cart Path18:47:27.6 8/6/2013: Caching Background Path18:47:27.6 8/6/2013: Validating: Emulator_2: Snap Path: G:\STUFF\Assets\Nintendo_SNES\Snap18:47:27.6 8/6/2013: Validating: Emulator_2: Background Snap Path: G:\STUFF\Assets\Nintendo_SNES\Background18:47:27.6 8/6/2013: Validating: Emulator_2: Video Snap Path: G:\STUFF\Assets\Nintendo_SNES\Video_MP418:47:27.6 8/6/2013: Validating: Emulator_2: Control Panel Path: G:\STUFF\Assets\Nintendo_SNES\Nintendo SNES\Controls18:47:27.6 8/6/2013: Validating: Emulator_2: Database: [Console] Nintendo SNES18:47:27.6 8/6/2013: Validating: Emulator_2: Title Snap Path: G:\STUFF\Assets\Nintendo_SNES\Title18:47:27.6 8/6/2013: Validating: Emulator_2: Box Art Path: G:\STUFF\Assets\Nintendo_SNES\Box18:47:27.6 8/6/2013: Warning: Emulator_2: Box Art Path Does not exist18:47:27.6 8/6/2013: Validating: Emulator_2: Cart Art Path: G:\STUFF\Assets\Nintendo_SNES\Cart18:47:27.6 8/6/2013: Validating: Emulator_2: Manual Path: G:\STUFF\Assets\Nintendo_SNES\Nintendo SNES\Manuals18:47:27.6 8/6/2013: Caching Video Snap Path18:47:27.6 8/6/2013: Caching Snap Path18:47:27.6 8/6/2013: Caching Title Path18:47:27.6 8/6/2013: Caching Cart Path18:47:27.6 8/6/2013: Caching Background Path18:47:27.6 8/6/2013: Validating: Emulator_3: Snap Path: G:\STUFF\Assets\Nintendo_N64\Snap18:47:27.6 8/6/2013: Validating: Emulator_3: Background Snap Path: G:\STUFF\Assets\Nintendo_N64\Background18:47:27.6 8/6/2013: Validating: Emulator_3: Video Snap Path: G:\STUFF\Assets\Nintendo_N64\Video_MP4_HI_QUAL18:47:27.6 8/6/2013: Validating: Emulator_3: Control Panel Path: G:\STUFF\Assets\Nintendo_N64\Nintendo N64\Controls18:47:27.6 8/6/2013: Validating: Emulator_3: Database: [Console] Nintendo N6418:47:27.6 8/6/2013: Validating: Emulator_3: Title Snap Path: G:\STUFF\Assets\Nintendo_N64\Title18:47:27.6 8/6/2013: Validating: Emulator_3: Box Art Path: G:\STUFF\Assets\Nintendo_N64\Box18:47:27.6 8/6/2013: Validating: Emulator_3: Cart Art Path: G:\STUFF\Assets\Nintendo_N64\Cart18:47:27.6 8/6/2013: Validating: Emulator_3: Manual Path: G:\STUFF\Assets\Nintendo_N64\Nintendo N64\Manuals18:47:27.6 8/6/2013: Caching Video Snap Path18:47:27.6 8/6/2013: Caching Snap Path18:47:27.6 8/6/2013: Caching Title Path18:47:27.6 8/6/2013: Caching Box Path18:47:27.6 8/6/2013: Caching Cart Path18:47:27.6 8/6/2013: Caching Background Path18:47:27.6 8/6/2013: Validating: Emulator_4: Snap Path: G:\STUFF\Assets\Nintendo_NES\Snap18:47:27.6 8/6/2013: Validating: Emulator_4: Background Snap Path: G:\STUFF\Assets\Nintendo_NES\Background18:47:27.6 8/6/2013: Validating: Emulator_4: Control Panel Path: G:\STUFF\Assets\Nintendo NES\Controls18:47:27.6 8/6/2013: Validating: Emulator_4: Database: [Console] Nintendo NES18:47:27.6 8/6/2013: Validating: Emulator_4: Title Snap Path: G:\STUFF\Assets\Nintendo_NES\Title18:47:27.6 8/6/2013: Validating: Emulator_4: Box Art Path: G:\STUFF\Assets\Nintendo_NES\Box18:47:27.6 8/6/2013: Validating: Emulator_4: Cart Art Path: G:\STUFF\Assets\Nintendo_NES\Cart18:47:27.6 8/6/2013: Validating: Emulator_4: Manual Path: G:\STUFF\Assets\Nintendo NES\Manuals18:47:27.6 8/6/2013: Caching Video Snap Path18:47:27.6 8/6/2013: Caching Snap Path18:47:27.6 8/6/2013: Caching Title Path18:47:27.6 8/6/2013: Caching Box Path18:47:27.6 8/6/2013: Caching Cart Path18:47:27.6 8/6/2013: Caching Background Path18:47:27.6 8/6/2013: Validating: Emulator_5: Snap Path: G:\STUFF\Assets\Nintendo_Gamecube\Nintendo GameCube\Snaps18:47:27.6 8/6/2013: Validating: Emulator_5: Background Snap Path: G:\STUFF\Assets\Nintendo_Gamecube\Background18:47:27.6 8/6/2013: Validating: Emulator_5: Video Snap Path: G:\STUFF\Assets\Nintendo_Gamecube\Video_MP4_HI_QUAL18:47:27.6 8/6/2013: Validating: Emulator_5: Control Panel Path: G:\STUFF\Assets\Nintendo_Gamecube\Controls18:47:27.6 8/6/2013: Warning: Emulator_5: Control Panel Path Does not exist18:47:27.6 8/6/2013: Validating: Emulator_5: Database: [Console] Nintendo GameCube18:47:27.6 8/6/2013: Validating: Emulator_5: Title Snap Path: G:\STUFF\Assets\Nintendo_Gamecube\Title18:47:27.6 8/6/2013: Warning: Emulator_5: Title Snap Path Does not exist18:47:27.6 8/6/2013: Validating: Emulator_5: Box Art Path: G:\STUFF\Assets\Nintendo_Gamecube\Box18:47:27.6 8/6/2013: Validating: Emulator_5: Cart Art Path: G:\STUFF\Assets\Nintendo_Gamecube\Nintendo GameCube\Cartridges18:47:27.6 8/6/2013: Validating: Emulator_5: Manual Path: G:\STUFF\Assets\Nintendo_Gamecube\Manuals18:47:27.6 8/6/2013: Warning: Emulator_5: Manual Path Does not exist18:47:27.6 8/6/2013: Caching Video Snap Path18:47:27.6 8/6/2013: Caching Snap Path18:47:27.6 8/6/2013: Caching Box Path18:47:27.6 8/6/2013: Caching Cart Path18:47:27.6 8/6/2013: Caching Background Path18:47:27.6 8/6/2013: Validating: Emulator_6: Snap Path: G:\STUFF\Assets\Nintendo_Game_Boy_Advance\Snap18:47:27.6 8/6/2013: Validating: Emulator_6: Background Snap Path: G:\STUFF\Assets\Nintendo_Game_Boy_Advance\Background18:47:27.6 8/6/2013: Validating: Emulator_6: Video Snap Path: G:\STUFF\Assets\Nintendo_Game_Boy_Advance\Video_MP418:47:27.6 8/6/2013: Validating: Emulator_6: Control Panel Path: G:\STUFF\Assets\Nintendo Game Boy\Controls18:47:27.6 8/6/2013: Validating: Emulator_6: Database: [Handheld] Nintendo Game Boy Advance18:47:27.6 8/6/2013: Validating: Emulator_6: Title Snap Path: G:\STUFF\Assets\Nintendo_Game_Boy_Advance\Title18:47:27.6 8/6/2013: Validating: Emulator_6: Box Art Path: G:\STUFF\Assets\Nintendo_Game_Boy_Advance\Box18:47:27.6 8/6/2013: Validating: Emulator_6: Cart Art Path: G:\STUFF\Assets\Nintendo_Game_Boy_Advance\Cart18:47:27.6 8/6/2013: Validating: Emulator_6: Manual Path: G:\STUFF\Assets\Nintendo Game Boy\Manuals18:47:27.6 8/6/2013: Caching Video Snap Path18:47:27.6 8/6/2013: Caching Snap Path18:47:27.6 8/6/2013: Caching Title Path18:47:27.6 8/6/2013: Caching Box Path18:47:27.7 8/6/2013: Caching Cart Path18:47:27.7 8/6/2013: Caching Background Path18:47:27.7 8/6/2013: Validating: Emulator_7: Snap Path: G:\STUFF\Assets\Sega_Master_System\Snap18:47:27.7 8/6/2013: Validating: Emulator_7: Background Snap Path: G:\STUFF\Assets\Sega_Master_System\Background18:47:27.7 8/6/2013: Validating: Emulator_7: Control Panel Path: G:\STUFF\Assets\Sega Master System\Controls18:47:27.7 8/6/2013: Validating: Emulator_7: Database: [Console] Sega Master System18:47:27.7 8/6/2013: Validating: Emulator_7: Title Snap Path: G:\STUFF\Assets\Sega_Master_System\Title18:47:27.7 8/6/2013: Validating: Emulator_7: Box Art Path: G:\STUFF\Assets\Sega_Master_System\Box18:47:27.7 8/6/2013: Validating: Emulator_7: Cart Art Path: G:\STUFF\Assets\Sega_Master_System\Cart18:47:27.7 8/6/2013: Validating: Emulator_7: Manual Path: G:\STUFF\Assets\Sega Master System\Manuals18:47:27.7 8/6/2013: Caching Video Snap Path18:47:27.7 8/6/2013: Caching Snap Path18:47:27.7 8/6/2013: Caching Title Path18:47:27.7 8/6/2013: Caching Box Path18:47:27.7 8/6/2013: Caching Cart Path18:47:27.7 8/6/2013: Caching Background Path18:47:27.7 8/6/2013: Validating: Emulator_8: Snap Path: G:\STUFF\Assets\Sega_Genesis\Snap18:47:27.7 8/6/2013: Validating: Emulator_8: Background Snap Path: G:\STUFF\Assets\Sega_Genesis\Background18:47:27.7 8/6/2013: Validating: Emulator_8: Video Snap Path: G:\STUFF\Assets\Sega_Genesis\Video_MP418:47:27.7 8/6/2013: Validating: Emulator_8: Control Panel Path: G:\STUFF\Assets\Sega_Genesis\Sega Genesis\Controls18:47:27.7 8/6/2013: Validating: Emulator_8: Database: [Console] Sega Genesis18:47:27.7 8/6/2013: Validating: Emulator_8: Title Snap Path: G:\STUFF\Assets\Sega_Genesis\Title18:47:27.7 8/6/2013: Validating: Emulator_8: Box Art Path: G:\STUFF\Assets\Sega_Genesis\Box18:47:27.7 8/6/2013: Validating: Emulator_8: Cart Art Path: G:\STUFF\Assets\Sega_Genesis\Cart18:47:27.7 8/6/2013: Validating: Emulator_8: Manual Path: G:\STUFF\Assets\Sega_Genesis\Sega Genesis\Manuals18:47:27.7 8/6/2013: Caching Video Snap Path18:47:27.7 8/6/2013: Caching Snap Path18:47:27.7 8/6/2013: Caching Title Path18:47:27.7 8/6/2013: Caching Box Path18:47:27.7 8/6/2013: Caching Cart Path18:47:27.7 8/6/2013: Caching Background Path18:47:27.7 8/6/2013: Validating: Emulator_9: Snap Path: G:\STUFF\Assets\Sega_Dreamcast\Snap18:47:27.7 8/6/2013: Validating: Emulator_9: Background Snap Path: G:\STUFF\Assets\Sega_Dreamcast\Background18:47:27.7 8/6/2013: Validating: Emulator_9: Video Snap Path: G:\STUFF\Assets\Sega_Dreamcast\Video_MP4_HI_QUAL18:47:27.7 8/6/2013: Validating: Emulator_9: Control Panel Path: G:\STUFF\Assets\Sega_Dreamcast\Sega Dreamcast\Controls18:47:27.7 8/6/2013: Validating: Emulator_9: Database: [Console] Sega Dreamcast18:47:27.7 8/6/2013: Validating: Emulator_9: Title Snap Path: G:\STUFF\Assets\Sega_Dreamcast\Title18:47:27.7 8/6/2013: Warning: Emulator_9: Title Snap Path Does not exist18:47:27.7 8/6/2013: Validating: Emulator_9: Box Art Path: G:\STUFF\Assets\Sega_Dreamcast\Box18:47:27.7 8/6/2013: Validating: Emulator_9: Cart Art Path: G:\STUFF\Assets\Sega_Dreamcast\CD18:47:27.7 8/6/2013: Validating: Emulator_9: Manual Path: G:\STUFF\Assets\Sega_Dreamcast\Sega Dreamcast\Manuals18:47:27.7 8/6/2013: Caching Video Snap Path18:47:27.7 8/6/2013: Caching Snap Path18:47:27.7 8/6/2013: Caching Box Path18:47:27.7 8/6/2013: Caching Cart Path18:47:27.7 8/6/2013: Caching Background Path18:47:27.7 8/6/2013: Validating: Emulator_10: Snap Path: G:\STUFF\Assets\Sony_Playstation\Snap18:47:27.7 8/6/2013: Validating: Emulator_10: Background Snap Path: G:\STUFF\Assets\Sony_Playstation\Background18:47:27.7 8/6/2013: Validating: Emulator_10: Video Snap Path: G:\STUFF\Assets\Sony_Playstation\Video_MP418:47:27.7 8/6/2013: Validating: Emulator_10: Control Panel Path: G:\STUFF\Assets\Sony_Playstation\Sony Playstation\Controls18:47:27.7 8/6/2013: Validating: Emulator_10: Database: [Console] Sony Playstation18:47:27.7 8/6/2013: Validating: Emulator_10: Title Snap Path: G:\STUFF\Assets\Sony_Playstation\Title18:47:27.7 8/6/2013: Validating: Emulator_10: Box Art Path: G:\STUFF\Assets\Sony_Playstation\Box18:47:27.7 8/6/2013: Validating: Emulator_10: Cart Art Path: G:\STUFF\Assets\Sony_Playstation\CD18:47:27.7 8/6/2013: Validating: Emulator_10: Manual Path: G:\STUFF\Assets\Sony_Playstation\Sony Playstation\Manuals18:47:27.7 8/6/2013: Warning: Emulator_10: MAPFile Does Not Exist18:47:27.7 8/6/2013: Caching Video Snap Path18:47:27.7 8/6/2013: Caching Snap Path18:47:27.7 8/6/2013: Caching Title Path18:47:27.7 8/6/2013: Caching Box Path18:47:27.7 8/6/2013: Caching Cart Path18:47:27.7 8/6/2013: Caching Background Path18:47:27.7 8/6/2013: Validating: Emulator_11: Snap Path: G:\STUFF\Assets\Sony_Playstation_2\Snap18:47:27.7 8/6/2013: Validating: Emulator_11: Background Snap Path: G:\STUFF\Assets\Sony_Playstation_2\Background18:47:27.7 8/6/2013: Validating: Emulator_11: Video Snap Path: G:\STUFF\Assets\Sony_Playstation_2\Video_MP418:47:27.7 8/6/2013: Validating: Emulator_11: Control Panel Path: G:\STUFF\Assets\Sony_Playstation_2\Sony Playstation 2\Controls18:47:27.7 8/6/2013: Validating: Emulator_11: Database: [Console] Sony PlayStation 218:47:27.7 8/6/2013: Validating: Emulator_11: Title Snap Path: G:\STUFF\Assets\Sony_Playstation_2\Title18:47:27.7 8/6/2013: Warning: Emulator_11: Title Snap Path Does not exist18:47:27.7 8/6/2013: Validating: Emulator_11: Box Art Path: G:\STUFF\Assets\Sony_Playstation_2\Box18:47:27.7 8/6/2013: Validating: Emulator_11: Cart Art Path: G:\STUFF\Assets\Sony_Playstation_2\Sony Playstation 2\Cartridges18:47:27.7 8/6/2013: Validating: Emulator_11: Manual Path: G:\STUFF\Assets\Sony_Playstation_2\Sony Playstation 2\Manuals18:47:27.7 8/6/2013: Warning: Emulator_11: MAPFile Does Not Exist18:47:27.7 8/6/2013: Caching Video Snap Path18:47:27.7 8/6/2013: Caching Snap Path18:47:27.7 8/6/2013: Caching Box Path18:47:27.7 8/6/2013: Caching Cart Path18:47:27.7 8/6/2013: Caching Background Path18:47:27.7 8/6/2013: Validating: Emulator_12: Snap Path: G:\STUFF\Assets\Future_Pinball\Snap18:47:27.7 8/6/2013: Validating: Emulator_12: Background Snap Path: G:\STUFF\Assets\Atari_2600\Background18:47:27.7 8/6/2013: Validating: Emulator_12: Video Snap Path: G:\STUFF\Assets\Future_Pinball\Video_MP4_HI_QUAL18:47:27.7 8/6/2013: Validating: Emulator_12: Control Panel Path: G:\STUFF\Assets\Future_Pinball\Future Pinball\Controls18:47:27.7 8/6/2013: Warning: Emulator_12: Control Panel Path Does not exist18:47:27.7 8/6/2013: Validating: Emulator_12: Database: [Pinball] Future Pinball18:47:27.7 8/6/2013: Validating: Emulator_12: Title Snap Path: G:\STUFF\Assets\Future_Pinball\Title18:47:27.7 8/6/2013: Warning: Emulator_12: Title Snap Path Does not exist18:47:27.7 8/6/2013: Validating: Emulator_12: Box Art Path: G:\STUFF\Assets\Future_Pinball\Box18:47:27.7 8/6/2013: Warning: Emulator_12: Box Art Path Does not exist18:47:27.7 8/6/2013: Validating: Emulator_12: Cart Art Path: G:\STUFF\Assets\Future_Pinball\Cart18:47:27.7 8/6/2013: Warning: Emulator_12: Cart Art Path Does not exist18:47:27.7 8/6/2013: Validating: Emulator_12: Manual Path: G:\STUFF\Assets\Future_Pinball\Future Pinball\Manuals18:47:27.7 8/6/2013: Warning: Emulator_12: Manual Path Does not exist18:47:27.7 8/6/2013: Caching Video Snap Path18:47:27.7 8/6/2013: Caching Snap Path18:47:27.7 8/6/2013: Caching Background Path18:47:30.8 8/6/2013: Restoring Emulator from Cache: 118:47:30.9 8/6/2013: Restoring Emulator Database From Cache: 118:47:30.9 8/6/2013: Restoring Emulator from Cache: 218:47:31.0 8/6/2013: Restoring Emulator Database From Cache: 218:47:31.0 8/6/2013: Restoring Emulator from Cache: 318:47:31.1 8/6/2013: Restoring Emulator Database From Cache: 318:47:31.1 8/6/2013: Restoring Emulator from Cache: 418:47:31.2 8/6/2013: Restoring Emulator Database From Cache: 418:47:31.2 8/6/2013: Restoring Emulator from Cache: 518:47:31.2 8/6/2013: Restoring Emulator Database From Cache: 518:47:31.2 8/6/2013: Restoring Emulator from Cache: 618:47:31.3 8/6/2013: Restoring Emulator Database From Cache: 618:47:31.4 8/6/2013: Restoring Emulator from Cache: 718:47:31.4 8/6/2013: Restoring Emulator Database From Cache: 718:47:31.5 8/6/2013: Restoring Emulator from Cache: 818:47:31.5 8/6/2013: Restoring Emulator Database From Cache: 818:47:31.6 8/6/2013: Restoring Emulator from Cache: 918:47:31.6 8/6/2013: Restoring Emulator Database From Cache: 918:47:31.6 8/6/2013: Restoring Emulator from Cache: 1018:47:31.6 8/6/2013: No Database Data: 1018:47:31.6 8/6/2013: Restoring Emulator from Cache: 1118:47:31.6 8/6/2013: No Database Data: 1118:47:31.6 8/6/2013: Restoring Emulator from Cache: 1218:47:31.6 8/6/2013: No Database Data: 1218:48:35.1 8/6/2013: Exiting GameEx!18:48:35.1 8/6/2013: Disposing all videos18:48:35.1 8/6/2013: Deleting temporary Karaoke videos18:48:35.1 8/6/2013: Disposing Image List18:48:35.1 8/6/2013: Disposing Fonts18:48:35.1 8/6/2013: Disposing Surfaces18:48:35.1 8/6/2013: Saving Settings18:48:35.1 8/6/2013: Shutting down Bass18:48:35.4 8/6/2013: Closing HideOS.exe18:48:35.5 8/6/2013: Disposing Plugins18:48:35.5 8/6/2013: Disposing Plugins18:48:35.5 8/6/2013: Closing database connection18:48:35.5 8/6/2013: Checking for applications to Launch On Exit18:48:35.5 8/6/2013: Media Center was not open when starting GameEx, so not launching18:48:35.5 8/6/2013: ByeAnd this is the steamdata.ini [AppID_24240]gamename=PAYDAY The Heistinstalldir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\PAYDAY The Heist[AppID_8980]gamename=Borderlandsinstalldir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\Borderlands[AppID_202170]gamename=Save 75% on Sleeping Dogsinstalldir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\SleepingDogs[AppID_41070]gamename=Serious Sam 3: BFEinstalldir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\Serious Sam 3description=Serious Sam 3: BFE is a glorious throwback to the golden age of first-person shooters where men were men, cover was for amateurs and pulling the trigger made things go boom. Serving as a prequel to the original indie sensation, Serious Sam: The First Encounter, Serious Sam 3 takes place during the Earths final struggle against Mentals invading legions of beasts and mercenaries. Set against the collapsing temples of an ancient civilization and the crumbling cities of 22nd century Egypt, Serious Sam 3 is an exhilarating fusion of classic twitch shooters and modern gameplay features.[-LF-]NO COVER. ALL MAN.[-LF-]Key Features:[-LF-]Frantic Arcade-Style Action Hold down the trigger and lay waste to a never-ending onslaught of attackers or face being overrun by Mentals savage beasts. No cover systems, no camping its just you against them. All of them.[-LF-]Fearsome Enemy Creatures A new battalion of unforgettable minions including the rumbling Scrapjack and towering Khnum join the legendary Headless Kamikaze, Gnaar and Sirian Werebull to create the fiercest opposition youve ever had the pleasure of mowing down.[-LF-]Spectacular Environments Battle across the expansive battlefields of near-future Egypt bursting at the seams with total chaos. The shattered cities of tomorrow lined with the crumbling temples of an ancient world become your destructible playground.[-LF-]Destructive Arsenal Unleash Serious Sams arsenal of weapons including a scoped assault rifle, the double-barreled shotgun, the explosive automatic shotgun, the punishing minigun, and the almighty barrage of flaming cannonballs! Carry all of Sams weapons at once and switch between each gun on the fly for maximum firepower.[-LF-]Brutal Melee Attacks When the going gets tough, the tough take matters into their own hands! Rip out the eye of a closing Gnaar, twist off the face of the hideous Scrapjack or snap the neck of an Arachnoid Hatchling for an instant kill.[-LF-]Co-Op Chaos Go to war against Mentals horde with up to 16 players online and annihilate everything that moves across 12 levels of mayhem. Try to survive wave after wave of enemies in the relentless Survival mode or go on a monstrous safari in Beast Hunt mode![-LF-]Pure Multiplayer Mayhem Drop the gauntlet and let the heavy ordinance fly in incredible versus modes like Deathmatch, Capture the Flag, Last Team Standing and My Burden. This is the next level of Serious Sam multiplayer and all hell is about to break loose![-LF-]Split Screen Modes Huddle up with split screen co-op and multiplayer versus modes with up to four players on one screen. Hey, stop looking at my screen![-LF-]genre=Actionyear=2011developer=Croteam[AppID_28050]gamename=Deus Ex: Human Revolutioninstalldir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\Deus Ex - Human Revolution[AppID_2700]gamename=RollerCoaster Tycoon® 3: Platinuminstalldir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\Rollercoaster Tycoon 3 Golddescription=Rollercoaster Tycoon 3 Platinum combines the excitement of rollercoasters with the fun of great strategy sim. RCT3 Platinum combines the roller coaster theme park fun of the Roller Coaster Tycoon 3 with included expansion packs Soaked! and Wild! Now enjoy more options than ever. Build your own water slide or create your own safari with real animals. Watch guest reactions to your ultimate theme park![-LF-][-LF-]Grab a front seat for the ride of your life with the jaw-dropping Coaster Cam.[-LF-]See every detail in stunning 3D with fully controllable park cameras.[-LF-]Cope with changing weather patterns and enjoy beautiful vistas, sunsets, moonlight, and more.[-LF-]Experience the latest extreme coasters and heart-pumping rides! Live Every spine tingling detail in stunning 3-D with fully controllable cameras.[-LF-]Spice up any backgrounds, rides, fireworks display and laser light shows with your own music.[-LF-]Create your own park guests and groups with the Peep Designer and experience their reactions to the rides you build! Soak them and watch their reactions! Send them on wild safari and let them pet the animals![-LF-]Create savage encounters and thrilling safaris! Conquer 12 Wild! Scenarios and experience cool jungle and prehistoric design themes.[-LF-]Play through dozens of scenarios in three difficulty modes or build without limits in Sandbox mode.[-LF-]Create pyrotechnic wonders and laser light shows with the RollerCoaster Tycoon® 3 MixMaster.[-LF-]genre=Simulationyear=2006developer=Frontier[AppID_72200]gamename=Universe Sandboxinstalldir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\Universe Sandboxdescription=Create and destroy on a scale youve never imagined with the ultimate space simulator. Harness the power to create black holes, collide galaxies, and manipulate gravity with just a few clicks. Inspired by the software astronomers use to unlock the mysteries of our universe, never before has astronomy been so interactive or so much fun. Spawn a massive moon to tear apart Saturns rings or launch a rogue star to rip the planets from their orbits around our sun. After unleashing catastrophic destruction, create your own solar system and share it with friends. Key Features: Interactive, real-time, n-body gravity simulator Change any property of any object at any time Real physics, real data, real units, real science Compare the objects in any simulation with chart mode Supports anaglyphic 3D glasses and 3D DLP televisions Built in tutorials and step-by-step activities Includes 70+ simulations both real and fantastical Extensive editing and creation tools make it easy to build your own simulations Latest version of Universe Sandbox 2.x with Steam Achievements[-LF-]genre=Indieyear=2011developer=Giant Army[AppID_8190]gamename=Just Cause 2installdir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\Just Cause 2[AppID_232210]installdir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\chivalrymedievalwarfarebetagamename=Chivalrymedievalwarfarebeta[AppID_219640]gamename=Chivalry: Medieval Warfareinstalldir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\chivalrymedievalwarfaredescription=Besiege castles and raid villages in Chivalry: Medieval Warfare, a fast-paced medieval FPS (Slasher with a Multi-player online focus) Chivalry: Medieval Warfare is a first-person slasher with a focus on multi-player. Featuring competitive online combat that seeks to capture the experience of truly being on a medieval battlefield. Inspired from the intensity and epicness of swordfighting movies such as 300, Gladiator and Braveheart, Chivalry: Medieval Warfare aims to bring that experience to the hands of a gamer. The game is skill-based and controls like a FPS, but instead of guns and grenades, players are given swords, shields, maces, battleaxes and longbows. Set in a fictional, yet gritty and realistic world, players will fight in fast paced online battles besieging castles, raiding medieval villages and fighting for glory in the arena with up to 32 players.Key Features: Deep melee combat system provides players with a huge range of responsive combat options Adjust your attacks and blocks in real time with the mouse for precise and full control of the actionWield an arsenal of up to 60 brutal weapons ranging from broad swords and battle axes to longbows and javelinsDynamic objective system brings team tactics and strategy to the forefront as players batter down gates, raid villages and assassinate enemy royalty to achieve victory.Use a variety of siege weapons ranging from catapults, boiling oil, ballista, battering rams and moreVast, lush environments that transport the player to a gritty and immersive medieval world. Offline play options that allow players to gain familiarity with the controls and gameplay before being thrust into the action.[-LF-]genre=Actionyear=2012developer=Torn Banner Studios[AppID_55230]gamename=Saints Row: The Thirdinstalldir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\Saints Row the Third[AppID_107100]gamename=Bastioninstalldir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\Bastiondescription=Bastion is an action role-playing experience that redefines storytelling in games, with a reactive narrator who marks your every move. Explore more than 40 lush hand-painted environments as you discover the secrets of the Calamity, a surreal catastrophe that shattered the world to pieces. Wield a huge arsenal of upgradeable weapons and battle savage beasts adapted to their new habitat. Finish the main story to unlock the New Game Plus mode and continue your journey! Key features: Stunning hand-painted artwork in full 1080p resolution Critically-acclaimed original music score Hours of reactive narration delivers a deep story Action-packed combat rewards playing with finesse Controls custom-tailored to PC plus gamepad support 10+ unique upgradeable weapons to be used 6 powerful Bastion structures to be discovered 'New Game Plus' mode unlocked after finishing the story Free Update: The Strangers Dream Delve deeper into the Bastion experience with this free update, featuring a challenging new scenario and new ways to play. Contents include: The Strangers Dream: a new fully narrated Who Knows Where sequence, bigger and tougher than the others. Score Attack Mode: a new way to play through the story! You start at level one with all Spirits and Idols unlocked. Combat performance is rated for efficiency, and all areas are repeatable. No-Sweat Mode: for those who just want to experience the story of Bastion, this mode provides unlimited chances to carry on from where you left off if youre defeated. Plus, new Steam Achievements and Leaderboards! To access the Strangers Dream sequence as well as Score Attack Mode, you need to have finished the game at least once. The Strangers Dream sequence will be available early on in your New Game Plus or Score Attack play-through.[-LF-]genre=Actionyear=2011developer=Supergiant Games[AppID_72850]gamename=Save 25% on The Elder Scrolls V: Skyriminstalldir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\Skyrim[AppID_1250]gamename=Killing Floorinstalldir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\KillingFloor[AppID_420]gamename=Half-Life 2: Episode Twoinstalldir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\Half-Life 2description=Half-Life® 2: Episode Two is the second in a trilogy of new games created by Valve that extends the award-winning and best-selling Half-Life® adventure.[-LF-]As Dr. Gordon Freeman, you were last seen exiting City 17 with Alyx Vance as the Citadel erupted amidst a storm of unknown proportions. In Episode Two, you must battle and race against Combine forces as you traverse the White Forest to deliver a crucial information packet stolen from the Citadel to an enclave of fellow resistance scientists.[-LF-]Episode Two extends the award-winning Half-Life gameplay with unique weapons, vehicles, and newly-spawned creatures.[-LF-]genre=Actionyear=2007developer=Valve[AppID_380]gamename=Half-Life 2: Episode Oneinstalldir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\Half-Life 2description=Half-Life 2 has sold over 4 million copies worldwide, and earned over 35 Game of the Year Awards. Episode One is the first in a series of games that reveal the aftermath of Half-Life 2 and launch a journey beyond City 17. Also features two multiplayer games. Half-Life 2 not required.[-LF-]genre=Actionyear=2006developer=Valve[AppID_220]gamename=Half-Life 2installdir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\Half-Life 2description=1998. HALF-LIFE sends a shock through the game industry with its combination of pounding action and continuous, immersive storytelling. Valve's debut title wins more than 50 game-of-the-year awards on its way to being named "Best PC Game Ever" by PC Gamer, and launches a franchise with more than eight million retail units sold worldwide.[-LF-]NOW. By taking the suspense, challenge and visceral charge of the original, and adding startling new realism and responsiveness, Half-Life 2 opens the door to a world where the player's presence affects everything around him, from the physical environment to the behaviors even the emotions of both friends and enemies.[-LF-]The player again picks up the crowbar of research scientist Gordon Freeman, who finds himself on an alien-infested Earth being picked to the bone, its resources depleted, its populace dwindling. Freeman is thrust into the unenviable role of rescuing the world from the wrong he unleashed back at Black Mesa. And a lot of people he cares about are counting on him.[-LF-]The intense, real-time gameplay of Half-Life 2 is made possible only by Source®, Valve's new proprietary engine technology. Source provides major enhancements in:[-LF-][-LF-]Characters: Advanced facial animation system delivers the most sophisticated in-game characters ever seen. With 40 distinct facial "muscles," human characters convey the full array of human emotion, and respond to the player with fluidity and intelligence.[-LF-]Physics: From pebbles to water to 2-ton trucks respond as expected, as they obey the laws of mass, friction, gravity, and buoyancy.[-LF-]Graphics: Source's shader-based renderer, like the one used at Pixar to create movies such as Toy Story® and Monster's, Inc.®, creates the most beautiful and realistic environments ever seen in a video game.[-LF-]AI: Neither friends nor enemies charge blindly into the fray. They can assess threats, navigate tricky terrain, and fashion weapons from whatever is at hand.[-LF-]genre=Actionyear=2004developer=Valve[AppID_49520]gamename=Borderlands 2installdir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\Borderlands 2[AppID_49600]gamename=Beat Hazardinstalldir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\Beat Hazarddescription=Welcome to a new experience in gameplay mechanics: Beat Hazard Gameplay Powered by YOUR Music! Experience your music collection like never before with this intense music driven arcade shooter. Each of your songs will have its own unique ebb and flow based on the music. Power up your spaceship and watch as the music boosts your firepower. Unleash hell on the enemy ships when you max out with weapon pickups! Beat Hazard seamlessly mixes the love of gaming and music. Together they become greater than the sum of their parts.Unique music driven gameplay Gameplay possibilities as vast as your music collection Can you last a whole album in Survival Mode? Go Head to Head in local 2 player mode Or play local 2 player Co-op 25 Steam achievements Compete against friends on Steam leader boards Get real time updates via the in game News System Take on huge boss ships Power up and unleash the deadly Beat Hazard weapon Rank up to an Elite rated pilot and beyond (Can you survive Suicidal mode?) Includes a kicking rock album to get you started File types supported: mp3/wav/aiff/ogg/mwa/flac iTunes, aac, mp4 and m4a support via a download for a small fee (to cover patented decoder licensing costs) LastFM Scrobble support Now also support Internet Radio in all modes, including online[-LF-]genre=Actionyear=2010developer=Cold Beam Games[AppID_730]gamename=Counter-Strike: Global Offensiveinstalldir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\Counter-Strike Global Offensivedescription=Operation Payback[-LF-]genre=Actionyear=2012developer=Valve[AppID_45000]gamename=Sol Survivorinstalldir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\SolSurvivordescription=Jump in to intense turret defense action with Sol Survivor! Build turrets to defend your colony and the innocent colonists within. Smash enemies with volleys of actively-controlled orbital support. Play with friends in co-operative and competitive multiplayer matches or test your mettle against our new Survival mode! Orbital Support - Get up close and personal with the enemy by calling down orbital lasers, salvos of artillery and many other weapons in support of your turrets. Never be stuck wishing your turrets could fire just one more shot! Huge Turret Arsenal - Twenty-six turrets are at the ready in the fight against the enemy, with each one filling a unique role. Try "old-time" strategies like cannons and mortars or ramp up the technology with banks of lasers and automated drones! 10 Unique Playstyles - Ten distinct executive officers bring unique combinations of turrets and support to the battlefield. Choose a favorite or pick the officer that best suits the challenge at hand! Immersive Camera and Controls - With a full rotational camera, the battlefield is at your fingertips. View the action from afar and plan strategies or get in close for precise actions! Exciting Co-Op and Multiplayer Modes - Choose from up to four game modes: the casual Duo mode, flexible Versus mode, challenging Co-Op or competitive Wars mode. Play with up to 8 friends! Survival Mode - Fight against tougher and tougher waves of enemies crafted randomly to create new challenges with each game. Challenge your friends to beat your best times! In-Game Encyclopedia - Always be well informed about the turrets and the enemy by consulting the in-game encyclopedia. Read up before starting a battle or check up on your knowledge quickly from the field.[-LF-]genre=Strategyyear=2010developer=Cadenza Interactive[AppID_440]gamename=Team Fortress 2installdir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\Team Fortress 2description=Robotic Boogaloo - The First Entirely Community-Created Update[-LF-]genre=Free to Playyear=2007developer=Valve[AppID_212480]gamename=Sonic & All-Stars Racing Transformedinstalldir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\Sonic & All-Stars Racing Transformeddescription=Steam Big Picture[-LF-]genre=Racingyear=2013developer=Sumo Digital[AppID_223530]installdir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\Left 4 Dead 2 Betagamename=Left 4 Dead 2 Beta [AppID_550]gamename=Left 4 Dead 2installdir=D:\\Program Files (x86)\\Steam\\steamapps\\common\\Left 4 Dead 2description=Set in the zombie apocalypse, Left 4 Dead 2 (L4D2) is the highly anticipated sequel to the award-winning Left 4 Dead, the #1 co-op game of 2008. This co-operative action horror FPS takes you and your friends through the cities, swamps and cemeteries of the Deep South, from Savannah to New Orleans across five expansive campaigns. You'll play as one of four new survivors armed with a wide and devastating array of classic and upgraded weapons. In addition to firearms, you'll also get a chance to take out some aggression on infected with a variety of carnage-creating melee weapons, from chainsaws to axes and even the deadly frying pan. You'll be putting these weapons to the test against (or playing as in Versus) three horrific and formidable new Special Infected. You'll also encounter five new uncommon common infected, including the terrifying Mudmen. Helping to take L4D's frantic, action-packed gameplay to the next level is AI Director 2.0. This improved Director has the ability to procedurally change the weather you'll fight through and the pathways you'll take, in addition to tailoring the enemy population, effects, and sounds to match your performance. L4D2 promises a satisfying and uniquely challenging experience every time the game is played, custom-fitted to your style of play. Next generation co-op action gaming from the makers of Half-Life, Portal, Team Fortress and Counter-Strike. Over 20 new weapons & items headlined by over 10 melee weapons axe, chainsaw, frying pan, baseball bat allow you to get up close with the zombies New survivors. New Story. New dialogue. Five expansive campaigns for co-operative, Versus and Survival game modes. An all new multiplayer mode. Uncommon common infected. Each of the five new campaigns contains at least one new uncommon common zombies which are exclusive to that campaign. AI Director 2.0: Advanced technology dubbed The AI Director drove L4D's unique gameplay customizing enemy population, effects, and music, based upon the players performance. L4D 2 features The AI Director 2.0 which expands the Directors ability to customize level layout, world objects, weather, and lighting to reflect different times of day. Stats, rankings, and awards system drives collaborative play[-LF-]genre=Actionyear=2009developer=Valve Link to comment Share on other sites More sharing options...
DazzleHP Posted August 7, 2013 Share Posted August 7, 2013 This may be completely irelevant, but do you have your Steam games installed on a non OS drive? In other words not on C:\? I only ask coz it can cause problems as i'm sure you're aware if you went down that rabbit hole. Link to comment Share on other sites More sharing options...
nullPointer Posted August 7, 2013 Share Posted August 7, 2013 Here are the steamdata.ini and log. it is also very strange for example you will see something in there called "Save 75% off of skyrim or something like that" which isnt even a game and i have skyrim and it is one of the ones not showing up.sorry if i wasnt supposed to just copy/paste the whole long thing here. No worries, we will simply revoke your cupcake privileges for today. Posting the files as attachments does help our mobile / tapatalk users to play along, but I'm on my desktop ATM so what do I care? Muah ha ha. I went ahead and put them in spoilers to save on the scrolling.So do me a favor delete your steamdata.ini (or if you prefer you can simply rename it as steamdata.ini.OLD or something), and restart GameEx. This will prompt GameEx to completely rebuild that file, and it may help it to correctly parse the games that are currently missing from your list. Link to comment Share on other sites More sharing options...
Link2097 Posted August 7, 2013 Author Share Posted August 7, 2013 First of all let me say sorry for not putting the logs in spoiler boxs i couldnt figure out how second yes my steam install is on my non os drive because i am using a 60GB SSD for windows 7 x64 and pretty much everything else goes on my other hddsand finally deleting the steamdata.ini helped but didnt fix all, for instance skyrim (the actual game) showed up but sonic adventure 2 still doesnt im kind of at a loss Link to comment Share on other sites More sharing options...
DazzleHP Posted August 7, 2013 Share Posted August 7, 2013 Please post your steamdata.ini found in the following directory:\GameEx\DATA\steamdata.iniIt would also be helpful to have a look at your gameex.ini, but that would be of secondary importance to the other requested files in this case. Please refer to the How to Ask For Help thread for details on how to access your log and gameex.ini.It seems to me, and i am by no way a Steam guru that it's finding some games and not others, probably because of the differing drives. Now you've confirmed that most of your Steam games are not on your OS drive we may need to see some more info to rule some things out. Please refer to nullPointer's post or above quote to forward the files we need to get you rolling Thanks! Link to comment Share on other sites More sharing options...
Link2097 Posted August 7, 2013 Author Share Posted August 7, 2013 It seems to me, and i am by no way a Steam guru that it's finding some games and not others, probably because of the differing drives. Now you've confirmed that most of your Steam games are not on your OS drive we may need to see some more info to rule some things out. Please refer to nullPointer's post or above quote to forward the files we need to get you rolling Thanks!well the thing that really is driving me nuts is that ALL of my steam games are on my non os drive in-fact they are all on the same drive in the same "SteamApps" folder so how it is finding some of them and not others confuses me.is there any other info i could provide? i looked a bit at the "asking for help" thread and i posted the files you asked for, what other logs or files could i post that could help? Link to comment Share on other sites More sharing options...
nullPointer Posted August 7, 2013 Share Posted August 7, 2013 Hi Link2097Please follow the steps listed in this post and see if that changes your situation at all. I've seen this sort of thing happen with mods and non-Steam games added to the client (namely Black Mesa), but I've never seen it happen with standard games purchased and installed through Steam.Just to verify, this is a registered version of GameEx correct? If it's not then that would be the source of the issue right there (i.e. full Steam integration is a registered feature). Link to comment Share on other sites More sharing options...
Link2097 Posted August 7, 2013 Author Share Posted August 7, 2013 Hi Link2097Please follow the steps listed in this post and see if that changes your situation at all. I've seen this sort of thing happen with mods and non-Steam games added to the client (namely Black Mesa), but I've never seen it happen with standard games purchased and installed through Steam.Just to verify, this is a registered version of GameEx correct? If it's not then that would be the source of the issue right there (i.e. full Steam integration is a registered feature).AWESOME! thank you that fixed all of them not showing up, all my installed steam games are now showing up.one last question though, do not all (or most?) games have videos , snaps , info , etc? or does it just take a bit for the program to gather that stuff?EDIT: it looks as if i found out the answer to my own question, gameex downloads steam assets while running. please consider this problem resolved (can i do that my self? i didnt see a place to edit thread only my posts) Link to comment Share on other sites More sharing options...
nullPointer Posted August 7, 2013 Share Posted August 7, 2013 Pretty much all Steam games have at least one snap and a banner. Most of them have a video, but there are also several that do not. It does does take a while for GameEx to scrape and download the associated media depending on the size of your Steam library and the speed of your internet connection. I typically just leave GameEx running for a while, and it pulls in all the necessary files. You can also supply your own Steam media in the event that you want to overwrite existing media or if there's anything missing (you start doing a lot of this if you add non-Steam games to your Steam library). All the Steam media for GameEx resides in the following directories:\GameEx\MEDIA\STEAM\BOXSNAPVIDEOIn this case all you need to do is figure out the Steam ID of the associated game (it will be the numeric AppID listed in your steamdata.ini), and rename the media files to match the Steam ID. Bingo bango done.Glad to hear it all worked out for you Link2097! Link to comment Share on other sites More sharing options...
Recommended Posts